Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00100) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Tumor necrosis factor
|
|||||
| Synonyms |
Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Tumor necrosis factor family
|
|||||
| Gene Name |
Tnf
|
|||||
| Organism |
Mus musculus (Mouse)
|
|||||
| Function |
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
DEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGM DLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCP KDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
|||||
| Sequence Length |
235
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Centyrin anti-TNF-alpha P191-22 | Research | Inhibitor | Kd: 1.2 nM | Research tool | [1] | |
| vNAR anti-TNF-alpha 3B11 | Research | Blocker | Kd: 16.7 nM | Diagnostic reagent | [2] | |
| References |
|---|