Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000414) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Centyrin anti-IL-17A TP1-C6
|
|||||
Synonyms |
Centyrin TP1-C6
|
|||||
Molecular Weight | 9.6 kDa | |||||
Thermal Denaturation TEMP | 45.6-87.3 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | CIS display | |||||
Highest Status | Research | |||||
Sequence Length | 89 | |||||
SBP Sequence |
>Centyrin anti-IL-17A TP1-C6
LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYFEDWWSGEAIVLTVPGSERSCDLTG LKPGTEYSVTIRGVKGGYPSSPLSAIFTT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Tencon | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS020 | [1] | ||||
Scaffold Name | Centyrin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Interleukin-17A | Inhibitor | Research tool | Kd: 1.8 nM | Janssen Research & Development, L.L.C. | [1] | |