General Information of Synthetic Binding Protein (SBP) (ID: SBP000412)
SBP Name
Repebody anti-Bcl-2 D3
Synonyms
Repebody D3
Molecular Weight 29.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli Origami B (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 266
SBP Sequence
>Repebody anti-Bcl-2 D3
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQ
YLPNVRYLALGGNKLHDISALKELTNLTYLALYINQLQSLPNGVFDKLTNLKELWLVHNQ
LQSLPDGVFDKLTNLTHLYLSWNQLQSLPKGVFDKLTNLTELDLSHNQLQSLPEGVFDKL
TQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRN
SAGSVAPDSAKCSGSGKPVRSIICPT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Repebody
Protein Scaffold Information of This SBP
Scaffold ID PS055
Scaffold Info
[1]
Scaffold Name Repebody
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Apoptosis regulator Bcl-2
BTS Info
Inhibitor Cancers [ICD-11: 2D4Z] Kd: 60 nM Korea Advanced Institute of Science and Technology (KAIST) [1]
References
1 Targeted delivery of a human Bcl-2-specific protein binder effectively induces apoptosis of cancer cells. Biochem Biophys Res Commun. 2020 May 28;526(2):447-452.