Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000412) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Repebody anti-Bcl-2 D3
|
|||||
Synonyms |
Repebody D3
|
|||||
Molecular Weight | 29.8 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli Origami B (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 266 | |||||
SBP Sequence |
>Repebody anti-Bcl-2 D3
ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQ YLPNVRYLALGGNKLHDISALKELTNLTYLALYINQLQSLPNGVFDKLTNLKELWLVHNQ LQSLPDGVFDKLTNLTHLYLSWNQLQSLPKGVFDKLTNLTELDLSHNQLQSLPEGVFDKL TQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRN SAGSVAPDSAKCSGSGKPVRSIICPT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Repebody | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS055 | [1] | ||||
Scaffold Name | Repebody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Apoptosis regulator Bcl-2 | Inhibitor | Cancers [ICD-11: 2D4Z] | Kd: 60 nM | Korea Advanced Institute of Science and Technology (KAIST) | [1] | |