Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00113) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Apoptosis regulator Bcl-2
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Bcl-2 family
|
|||||
| Gene Name |
Bcl2
|
|||||
| Organism |
Mus musculus (Mouse)
|
|||||
| Function |
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
|||||
| Sequence Length |
236
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| DARPin anti-Bcl-2 008_H10 | Research | Inhibitor | Kd: 0.058 nM | Tools for biotechnological high-throughput applications | [1] | |
| DARPin anti-Bcl-2/BCL-XL/Bcl-W 008_C6 | Research | Inhibitor | Kd: 0.03 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Repebody anti-Bcl-2 D3 | Research | Inhibitor | Kd: 60 nM | Cancers [ICD-11: 2D4Z] | [2] | |
| References |
|---|