Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000323) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
ABD-derived affinity protein anti-IFNG clone 20
|
|||||
| Synonyms |
ABD20
|
|||||
| Molecular Weight | 5.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Ribosome display | |||||
| Highest Status | Research | |||||
| Sequence Length | 46 | |||||
| SBP Sequence |
>ABD-derived affinity protein anti-IFNG clone 20
LAEAKVLANRELDKYGVSDRYKNLINYASTVALVKSWIDLILAGLP |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Albumin-binding domain (ABD) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS001 | [1] | ||||
| Scaffold Name | ABD-derived affinity protein | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Interferon gamma | Binder | Diagnostic reagent; Next generation protein therapeutics | Kd: 2.7 nM | Institute of Microbiology of the ASCR | [1] | |