General Information of Binding Target of SBP (BTS) (ID: ST00004)
BTS Name
Interferon gamma
Synonyms
IFN-gamma; Immune interferon
BTS Type
Protein
Family
Type II (or gamma) interferon family
Gene Name
IFNG
Organism
Homo sapiens (Human)
Function
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation (By similarity).
UniProt ID
P01579
UniProt Entry
IFNG_HUMAN
PFam
PF00714
Gene ID
3458
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Sequence Length
166
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
ABD-derived affinity protein anti-IFNG clone 20 Research Binder Kd: 2.7 nM Diagnostic reagent; Next generation protein therapeutics
SBP Info
[1]
ABD-derived affinity protein anti-IFNG clone 223 Research Binder Kd: 4.6 nM Diagnostic reagent; Next generation protein therapeutics
SBP Info
[1]
ABD-derived affinity protein anti-IFNG clone 275 Research Binder Kd: 8.4 nM Diagnostic reagent; Next generation protein therapeutics
SBP Info
[1]
ABD-derived affinity protein anti-IFNG clone 29 Research Binder Kd: 1.8 nM Diagnostic reagent; Next generation protein therapeutics
SBP Info
[1]
ABD-derived affinity protein anti-IFNG clone 35 Research Binder Kd: 10 nM Diagnostic reagent; Next generation protein therapeutics
SBP Info
[1]
ABD-derived affinity protein anti-IFNG clone 40 Research Binder Kd: 9.2 nM Diagnostic reagent; Next generation protein therapeutics
SBP Info
[1]
References
1 Novel high-affinity binders of human interferon gamma derived from albumin-binding domain of protein G. Proteins. 2012 Mar;80(3):774-89.