General Information of Synthetic Binding Protein (SBP) (ID: SBP000322)
SBP Name
ABD-derived affinity protein anti-IFNG clone 223
Synonyms
ABD223
Molecular Weight 5.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Ribosome display
Highest Status Research
Sequence Length 46
SBP Sequence
>ABD-derived affinity protein anti-IFNG clone 223
LAEAKVLANRELDKYGVSDWYKNQINDACQVSPVKTKIDSILAILP
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Albumin-binding domain (ABD)
Protein Scaffold Information of This SBP
Scaffold ID PS001
Scaffold Info
[1]
Scaffold Name ABD-derived affinity protein
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Interferon gamma
BTS Info
Binder Diagnostic reagent; Next generation protein therapeutics Kd: 4.6 nM Institute of Microbiology of the ASCR [1]
References
1 Novel high-affinity binders of human interferon gamma derived from albumin-binding domain of protein G. Proteins. 2012 Mar;80(3):774-89.