Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000177) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Peptide aptamer anti-Ras Pep141
|
|||||
| Synonyms |
Peptide aptamer Pep141
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Variable region
WWGYLGKLFQTETDRSQGALGPRPMCFILVEAVFASAACDSC |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS051 | [1] , [2] | ||||
| Scaffold Name | Peptide aptamer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Beta-Sheets + Loops | |||||