Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000177)
SBP Name
Peptide aptamer anti-Ras Pep141
Synonyms
Peptide aptamer Pep141
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Research
SBP Sequence
>Variable region
WWGYLGKLFQTETDRSQGALGPRPMCFILVEAVFASAACDSC
Protein Scaffold Information of This SBP
Scaffold ID PS051
Scaffold Info
[1] , [2]
Scaffold Name Peptide aptamer
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
GTPase HRas
BTS Info
Inhibitor Tools for protein function modulation IC50: 100 nM Memorial Sloan-Kettering Cancer Center [1] , [2]
References
1 Inactivation of Ras function by allele-specific peptide aptamers. Oncogene. 2002 Aug 22;21(37):5753-7.
2 Peptide aptamers with biological and therapeutic applications. Curr Med Chem. 2011;18(27):4215-22.