Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000124) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
DARPin anti-CASP-7 C7_16
|
|||||
| Synonyms |
DARPin C7_16
|
|||||
| Molecular Weight | 16.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Ribosome display | |||||
| Highest Status | Research | |||||
| PDB ID | 4JB8 | |||||
| Sequence Length | 161 | |||||
| SBP Sequence |
>DARPin anti-CASP-7 C7_16
GSDLGKKLLDAASAGQDDEVRILMANGADVNASNQQGWTPLHATAEYGHLEIVDVLLAYG ADVNASDSYGSTPLHSAAWAGHLEIVDVLLAHGADVNASDNYGWTPLHLAAHTGHLEIVD VLLANGADVNANNWWGKTPFDLAIDNGNEDIAEVLQKAAKL |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS027 | [1] | ||||
| Scaffold Name | DARPin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Caspase-7 | Inhibitor | Research tool | Kd: 44 nM | University of Zurich | [1] | |