Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000072) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Anticalin anti-Digoxigenin DigA16/20
|
|||||
Synonyms |
Anticalin DigA16/20
|
|||||
Molecular Weight | 13.7 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli JM83 | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 120 | |||||
SBP Sequence |
>Anticalin anti-Digoxigenin DigA16/20
WSQYHGKWWQVAAYPDHITKYGKCGWAEYTPEGKSVKVSRYSVIHGKEYFSEGTAYPVGD SKIGKIYHSYTIGGVTQGGVFNVLSTDNKNYIIGYFCRYDEDKKGHQDLVWVLSRSMVLT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Bilin-binding protein | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS011 | [1] | ||||
Scaffold Name | Anticalin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Digoxigenin | Binder | Research tool | Kd: 48.2 nM | Technical University of Munich | [1] | |