Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00329) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Alpha-mammal toxin AaH2
|
|||||
| Synonyms |
AaH II; AaHII; Neurotoxin II; Toxin II
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Long (4 C-C) scorpion toxin superfamily;
Sodium channel inhibitor family; Alpha subfamily |
|||||
| Organism |
Androctonus australis (Sahara scorpion)
|
|||||
| Function |
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels It is active on rat brain Nav1.2/SCN2A sodium channel (EC(50)=2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC(50)=2.2 nM) This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MNYLVMISLALLFVTGVESVKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASP
YGNACYCYKLPDHVRTKGPGRCHGR |
|||||
| Sequence Length |
85
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Nanobody anti-AaHII hu2NbAahII10-FERG | Research | Neutralizer | Kd: 0.67 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII hu2NbAahII10-FERG-C/S | Research | Neutralizer | Kd: 1.0 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII hu3NbAahII10-FERG | Research | Neutralizer | Kd: 0.73 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII hu3NbAahII10FGLGC/S | Research | Neutralizer | Kd: 0.93 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII NbAahII10 | Research | Neutralizer | Kd: 0.93 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII NbAahII10C/A | Research | Neutralizer | Kd: 0.53 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII NbAahII10C/S | Research | Neutralizer | Kd: 0.63 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |
| Nanobody anti-AaHII NbAahII10C/T | Research | Neutralizer | Kd: 2.3 nM | Parkinson disease [ICD-11: XM9DM8] | [1] | |