Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003348) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-AaHII hu3NbAahII10FGLGC/S
|
|||||
| Synonyms |
Nanobody hu3NbAahII10FGLGC/S
|
|||||
| Thermal Denaturation TEMP | 65 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | beta-D-thiogalactoside | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>Nanobody anti-AaHII hu3NbAahII10FGLGC/S
QVQLVESGGGLVQPGGSLRLSCAASGYFYSSNYSLGWFRQAPGKGLEOVAQINIAPGRIY YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASTAGNMYYGLRGPADFDYWGQG TLVTVSS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | NbAahII10 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Alpha-mammal toxin AaH2 | Neutralizer | Parkinson disease [ICD-11: XM9DM8] | Kd: 0.93 nM | Institut Pasteur de Tunis | [1] | |