General Information of Synthetic Binding Protein (SBP) (ID: SBP003348)
SBP Name
Nanobody anti-AaHII hu3NbAahII10FGLGC/S
Synonyms
Nanobody hu3NbAahII10FGLGC/S
Thermal Denaturation TEMP 65 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System beta-D-thiogalactoside
Highest Status Research
SBP Sequence
>Nanobody anti-AaHII hu3NbAahII10FGLGC/S
QVQLVESGGGLVQPGGSLRLSCAASGYFYSSNYSLGWFRQAPGKGLEOVAQINIAPGRIY
YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASTAGNMYYGLRGPADFDYWGQG
TLVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name NbAahII10
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Alpha-mammal toxin AaH2
BTS Info
Neutralizer Parkinson disease [ICD-11: XM9DM8] Kd: 0.93 nM Institut Pasteur de Tunis [1]
References
1 Development of Cys38 knock-out and humanized version of NbAahII10 nanobody with improved neutralization of AahII scorpion toxin. Protein Eng Des Sel. 2011 Sep;24(9):727-35.