General Information of Synthetic Binding Protein (SBP) (ID: SBP003341)
SBP Name
Nanobody anti-AaHII NbAahII10
Synonyms
Nanobody NbAahII10
Molecular Weight 13.8 kDa
Thermal Denaturation TEMP 67 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System beta-D-thiogalactoside
Highest Status Research
SBP Sequence
>Nanobody anti-AaHII NbAahII10
QVQLVESGGGSVQAGGSLKLSCAASGYFYSSNYCLGWFRQAPGKEREGVAQINIAPGRIY
YADSVKGRFTISRDNAKNTVYLQMDSLKPEDTAIYYCASTAGNMYYGLRGPADFDYWGQG
TQVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Alpha-mammal toxin AaH2
BTS Info
Neutralizer Parkinson disease [ICD-11: XM9DM8] Kd: 0.93 nM Institut Pasteur de Tunis [1]
References
1 Development of Cys38 knock-out and humanized version of NbAahII10 nanobody with improved neutralization of AahII scorpion toxin. Protein Eng Des Sel. 2011 Sep;24(9):727-35.