Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00245) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Major prion protein
|
|||||
| Synonyms |
PrP; PrP27-30; PrP33-35C; CD antigen CD230
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Prion family
|
|||||
| Gene Name |
Prnp
|
|||||
| Organism |
Mus musculus (Mouse)
|
|||||
| Function |
Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as an agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By similarity). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu(2+) or ZN(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPH
GGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAV VGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVN ITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPP VILLISFLIFLIVG |
|||||
| Sequence Length |
254
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Peptide aptamer anti-PrP clone 8 | Research | Binder | N.A. | Prion diseases [ICD-11: 8E0Z] | [1] | |
| Peptide aptamer anti-PrP clone 8-46K | Research | Binder | N.A. | Prion diseases [ICD-11: 8E0Z] | [1] | |
| Peptide aptamer anti-PrP clone 8-46Q | Research | Binder | N.A. | Prion diseases [ICD-11: 8E0Z] | [1] | |
| Peptide aptamer anti-PrP clone 8-47H | Research | Binder | N.A. | Prion diseases [ICD-11: 8E0Z] | [1] | |