Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00236) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Capsid protein
|
|||||
| Synonyms |
Core antigen; Core protein; HBcAg; p21.5
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Orthohepadnavirus core antigen family;
Orthohepadnavirus precore antigen family |
|||||
| Gene Name |
Pre C,C
|
|||||
| Organism |
Hepatitis B virus (HBV)
|
|||||
| Function |
Encapsidates hepatitis delta genome.; May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells.; Self assembles to form an icosahedral capsid. Most capsid appear to be large particles with a icosahedral symmetry of T=4 and consist of 240 copies of capsid protein, though a fraction forms smaller T=3 particles consisting of 180 capsid proteins. Entering capsid are transported along microtubules to the nucleus. Phosphorylation of the capsid is thought to induce exposure of nuclear localization signal in the C-terminal portion of the capsid protein that allows binding to the nuclear pore complex via the importin (karyopherin-) alpha and beta. Capsids are imported in intact form through the nuclear pore into the nuclear basket, where it probably binds NUP153. Only capsids that contain the mature viral genome can release the viral DNA and capsid protein into the nucleoplasm. Immature capsids get stucked in the basket. Capsids encapsulate the pre-genomic RNA and the P protein. Pre-genomic RNA is reverse transcribed into DNA while the capsid is still in the cytoplasm. The capsid can then either be directed to the nucleus, providing more genome for transcription, or bud through the endoplasmic reticulum to provide new virions.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLL
DTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNV NMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRR RGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC |
|||||
| Sequence Length |
212
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Peptide aptamer anti-HBV C1-1 | Research | Inhibitor | N.A. | Hepatitis B virus infection [ICD-11: XN0GA] | [1], [2] | |
| Peptide aptamer anti-HBV clone 34 | Research | Inhibitor | N.A. | Hepatitis B virus infection [ICD-11: XN0GA] | [3], [2] | |
| References |
|---|