Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00207) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Mixed lineage kinase domain-like protein
|
|||||
| Synonyms |
hMLKL
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Protein kinase superfamily
|
|||||
| Gene Name |
MLKL
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process Does not have protein kinase activity Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma membrane and execution of programmed necrosis characterized by calcium influx and plasma membrane damage In addition to TNF-induced necroptosis, necroptosis can also take place in the nucleus in response to orthomyxoviruses infection: following activation by ZBP1, MLKL is phosphorylated by RIPK3 in the nucleus, triggering disruption of the nuclear envelope and leakage of cellular DNA into the cytosol.following ZBP1 activation, which senses double-stranded Z-RNA structures, nuclear RIPK3 catalyzes phosphorylation and activation of MLKL, promoting disruption of the nuclear envelope and leakage of cellular DNA into the cytosol (By similarity). Binds to highly phosphorylated inositol phosphates such as inositolhexakisphosphate (InsP6) which is essential for its necroptotic function
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI AIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMS LGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK |
|||||
| Sequence Length |
471
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Monobody anti-MLKL clone 26 | Research | Binder | Kd: 176 nM | Tools for inducing necroptotic cell death | [1] | |
| Monobody anti-MLKL clone 27 | Research | Binder | Kd: 75 nM | Tools for inducing necroptotic cell death | [1] | |
| Monobody anti-MLKL clone 32 | Research | Blocker | Kd: 37.1 nM | Tools for identification of MLKL membrane translocation as a checkpoint in necroptotic cell death | [2] | |
| Monobody anti-MLKL clone 33 | Research | Blocker | Kd: 141 nM | Tools for identification of MLKL membrane translocation as a checkpoint in necroptotic cell death | [2] | |
| Monobody anti-MLKL clone 37 | Research | Blocker | Kd: 170 nM | Tools for identification of MLKL membrane translocation as a checkpoint in necroptotic cell death | [2] | |
| References |
|---|