Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001266)
SBP Name
Monobody anti-MLKL clone 32
Synonyms
Mb32; MLKL_32
Molecular Weight 10.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display and Yeast display
Highest Status Research
Sequence Length 96
SBP Sequence
>Monobody anti-MLKL clone 32
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYIITYGETGGNSPVQTFEVPGSKSTATIS
GLSPGVDYTITVYAYSFMYHDYYYPEWSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Mixed lineage kinase domain-like protein
BTS Info
Blocker Tools for identification of MLKL membrane translocation as a checkpoint in necroptotic cell death Kd: 37.1 nM Walter and Eliza Hall Institute of Medical Research [1]
References
1 Identification of MLKL membrane translocation as a checkpoint in necroptotic cell death using Monobodies. Proc Natl Acad Sci U S A. 2020 Apr 14;117(15):8468-8475.