Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00198) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
PR domain zinc finger protein 14
|
|||||
| Synonyms |
EC 2.1.1.-; PR domain-containing protein 14
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Class V-like SAM-binding methyltransferase superfamily
|
|||||
| Gene Name |
PRDM14
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Transcription factor that has both positive and negative roles on transcription. Required for the maintenance of embryonic stem cell identity and the reacquisition of pluripotency in somatic cells. May play an essential role in germ cell development at 2 levels: the reacquisition of potential pluripotency, including SOX2 up-regulation, and successful epigenetic reprogramming, characterized by EHMT1 repression. Its association with CBFA2T2 is required for the functions in pluripotency and germ cell formation (By similarity). Directly up-regulates the expression of pluripotency gene POU5F1 through its proximal enhancer. Binds to the DNA consensus sequence 5'-GGTC[TC]CTAA-3'.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAA
SAAPAMPPFPFRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHE YAGASSEDLGHQIIGGDNESGPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSED GPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQ TLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRFGPFQGKVVNASEVKTYGDNS VMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFYESCKEIHQNQ ELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLK YTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHM RVHSGDRPYQCVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSH KEDDGCSCSICGKIFSDQETFYSHMKFHEDY |
|||||
| Sequence Length |
571
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Monobody anti-Prdm14 L13 | Research | Inhibitor | Kd: 150 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 L15 | Research | Inhibitor | Kd: 89 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 L3 | Research | Inhibitor | Kd: 51 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 L5 | Research | Inhibitor | Kd: 93 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 L7 | Research | Inhibitor | Kd: 10 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 L9 | Research | Inhibitor | Kd: 125 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 S10 | Research | Inhibitor | Kd: 59 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 S14 | Research | Inhibitor | Kd: 63 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 S14-1 | Research | Inhibitor | Kd: 73 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 S2 | Research | Inhibitor | Kd: 76 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 S3 | Research | Inhibitor | Kd: 38 nM | Leukemia [ICD-11: 2B33.4] | [1] | |
| Monobody anti-Prdm14 S4 | Research | Inhibitor | Kd: <50 nM | Tools for determining the three-dimensional structure of Prdm1 and Mtgr1 | [1] | |
| Monobody anti-Prdm14 S5 | Research | Inhibitor | Kd: 100 nM | Leukemia [ICD-11: 2B33.4] | [1] | |