Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001188) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-Prdm14 S4
|
|||||
| Synonyms |
Monobody S4
|
|||||
| Molecular Weight | 10.4 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| PDB ID | 5ECJ | |||||
| Sequence Length | 96 | |||||
| SBP Sequence |
>Monobody anti-Prdm14 S4
VSSVPTKLEVVAATPTSLLISWDAPAVTVVLYHITYGETGGNSPVQFFTVPGSKSTATIS GLSPGVDYTITVYATYRLWGSWQYYYSSPISINYRT |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Side library | |||||
| Template Sequence Description | O represents a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U represents a mixture of His, Leu, Phe and Tyr; Z represents a mixture of Ala, Glu, Lys and Thr. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| PR domain zinc finger protein 14 | Inhibitor | Tools for determining the three-dimensional structure of Prdm1 and Mtgr1 | Kd: <50 nM | Stanford University School of Medicine | [1] | |