General Information of Synthetic Binding Protein (SBP) (ID: SBP001201)
SBP Name
Monobody anti-Prdm14 L15
Synonyms
Monobody L15
Molecular Weight 10.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display and Yeast display
Highest Status Research
Sequence Length 93
SBP Sequence
>Monobody anti-Prdm14 L15
VSSVPTKLEVVAATPTSLLISWDAYPGYPYVNYYRITYGETGGNSPVQEFTVPYYYSTAT
ISGLKPGVDYTITVYASYSPWYSYSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; B denotes a mixture of Gly, Ser and Tyr; J denotes a mixture of Ser and Tyr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
PR domain zinc finger protein 14
BTS Info
Inhibitor Leukemia [ICD-11: 2B33.4] Kd: 89 nM Stanford University School of Medicine [1]
References
1 ETO family protein Mtgr1 mediates Prdm14 functions in stem cell maintenance and primordial germ cell formation. Elife. 2015 Nov 2;4:e10150.