Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00194) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Nuclear receptor subfamily 1 group I member 2
|
|||||
| Synonyms |
Orphan nuclear receptor PAR1; Orphan nuclear receptor PXR; Pregnane X receptor; Steroid and xenobiotic receptor; SXR
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Nuclear hormone receptor family;
NR1 subfamily |
|||||
| Gene Name |
NR1I2
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF ATPLMQELFGITGS |
|||||
| Sequence Length |
434
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Monobody anti-PXR clone 1 | Research | Binder | Kd: 11.4 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 2 | Research | Binder | Kd: 93.7 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 3 | Research | Binder | Kd: 2.3 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 4 | Research | Binder | Kd: 6.3 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 5 | Research | Binder | Kd: 5.6 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 6 | Research | Binder | Kd: 1.8 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 7 | Research | Binder | Kd: 0.6 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |
| Monobody anti-PXR clone 8 | Research | Binder | Kd: 4.7 nM | Rheumatoid arthritis [ICD-11: FA20.Z] | [1] | |