Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001231) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-PXR clone 5
|
|||||
Synonyms |
Adnectin-5
|
|||||
Molecular Weight | 11.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | mRNA display | |||||
Highest Status | Research | |||||
Sequence Length | 102 | |||||
SBP Sequence |
>Monobody anti-PXR clone 5
MGVSDVPRDLEVVAATPTSLLISWKYPYETISYYRITYGETGGNSPVQEFTVPYYRSTAT ISGLKPGVDYTITVYAVEASAPYSDGGSPISINYRTEIDKPS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | 10th domain of fibronectin type III (10Fn3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Nuclear receptor subfamily 1 group I member 2 | Binder | Rheumatoid arthritis [ICD-11: FA20.Z] | Kd: 5.6 nM | Bristol-Myers Squibb Research & Development | [1] | |