General Information of Synthetic Binding Protein (SBP) (ID: SBP001231)
SBP Name
Monobody anti-PXR clone 5
Synonyms
Adnectin-5
Molecular Weight 11.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method mRNA display
Highest Status Research
Sequence Length 102
SBP Sequence
>Monobody anti-PXR clone 5
MGVSDVPRDLEVVAATPTSLLISWKYPYETISYYRITYGETGGNSPVQEFTVPYYRSTAT
ISGLKPGVDYTITVYAVEASAPYSDGGSPISINYRTEIDKPS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name 10th domain of fibronectin type III (10Fn3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Nuclear receptor subfamily 1 group I member 2
BTS Info
Binder Rheumatoid arthritis [ICD-11: FA20.Z] Kd: 5.6 nM Bristol-Myers Squibb Research & Development [1]
References
1 Developing Adnectins that target SRC co-activator binding to PXR: a structural approach toward understanding promiscuity of PXR. J Mol Biol. 2015 Feb 27;427(4):924-942.