Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001230) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-PXR clone 4
|
|||||
| Synonyms |
Adnectin-4
|
|||||
| Molecular Weight | 11.0 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | mRNA display | |||||
| Highest Status | Research | |||||
| Sequence Length | 105 | |||||
| SBP Sequence |
>Monobody anti-PXR clone 4
MASTSGVSDVPRDLEVVAATPTSLLISWDAPAVTVHSYYITYQELQHHSVPQGFQvPGSK STATISGLKPGVAYQIAVYAFTGPGLPPSDAPPIVIYYRTEGSGS |
|||||
| Template Name | 10th domain of fibronectin type III (10Fn3) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Nuclear receptor subfamily 1 group I member 2 | Binder | Rheumatoid arthritis [ICD-11: FA20.Z] | Kd: 6.3 nM | Bristol-Myers Squibb Research & Development | [1] | |