Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00181) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Alpha-crystallin
|
|||||
| Synonyms |
Acr; 14 kDa antigen; 16 kDa antigen; HSP 16.3; Nox16
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Small heat shock protein (HSP20) family
|
|||||
| Gene Name |
hspX
|
|||||
| Organism |
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
|
|||||
| Function |
Acts as a chaperone, as it has a significant ability to suppress the thermal denaturation of alcohol dehydrogenase. Cells overexpressing this gene grow more slowly than wild-type cells, and are less susceptible to autolysis following saturation of the culture in vitro, suggesting this protein may slow down the growth rate of M.tuberculosis in culture and by extension during macrophage infection.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGV
DPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKG ILTVSVAVSEGKPTEKHIQIRSTN |
|||||
| Sequence Length |
144
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Human VH dAb anti-Acr VH E3(Y391W) | Research | Binder | N.A. | Latent tuberculosis [ICD-11: 1B14] | [1] | |
| Human VH dAb anti-Acr VH F1(M394E) | Research | Binder | N.A. | Latent tuberculosis [ICD-11: 1B14] | [1] | |
| scFv anti-TB B4m1 | Research | Binder | N.A. | Research tool | [2] | |
| scFv anti-TB B4m2 | Research | Binder | N.A. | Research tool | [2] | |
| scFv anti-TB B4m3 | Research | Binder | N.A. | Research tool | [2] | |