General Information of Binding Target of SBP (BTS) (ID: ST00168)
BTS Name
Fusion glycoprotein F0
Synonyms
F2; p27; Intervening segment; Pep27; Peptide 27; Fusion glycoprotein F1; F1]
BTS Type
Protein
Family
Paramyxoviruses fusion glycoprotein family
Gene Name
F
Organism
Human respiratory syncytial virus A (strain A2)
Function
[Fusion glycoprotein F0]: Inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.; [Fusion glycoprotein F1]: Class I viral fusion protein Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state During viral and plasma cell membrane fusion, the coiled coil regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain The formation of this structure appears to drive apposition and subsequent fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm This fusion is pH independent and occurs at the plasma or endosomal membrane (Probable). The trimer of F1-F2 (F protein) also facilitates the attachment to host cell by binding to host heparan sulfate F protein is involved in the entry into the host cell through the interaction with host IGFR1 This interaction activates PRKCZ/PKCzeta that recruits host NCL/nucleolin to the apical cell surface where it can bind fusion glycoprotein F1 Later in infection, F protein expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis F protein may trigger p53-dependent apoptosis ; [Fusion glycoprotein F2]: Major determinant of the species specificity of RSV infection The trimer of F1-F2 (F protein) also facilitates the attachment to host cell by binding to host heparan sulfate F protein is involved in the entry into the host cell through the interaction with host IGFR1 This interaction activates PRKCZ/PKCzeta that recruits host NCL/nucleolin to the apical cell surface where it can bind fusion glycoprotein F1 Later in infection, F protein expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis F protein seems to trigger p53-dependent apoptosis
UniProt ID
P03420
UniProt Entry
FUS_HRSVA
PFam
PF00523
Sequence
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIE
LSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLN
NAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVS
LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVN
AGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYV
VQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKV
QSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP
LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLS
LIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Sequence Length
574
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Fab anti-Glycoprotein-F A7 Research Binder Kd: 0.036 nM Tools for de novo antibody discovery and engineering
SBP Info
[1]
Fab anti-Glycoprotein-F B23 Research Binder Kd: 0.667 nM Tools for de novo antibody discovery and engineering
SBP Info
[1]
Fab anti-Glycoprotein-F clone 19 Research Binder N.A. Human respiratory syncytial virus infection [ICD-11: XN275]
SBP Info
[2]
Fab anti-Glycoprotein-F F8 Research Binder Kd: 0.052 nM Tools for de novo antibody discovery and engineering
SBP Info
[1]
Fab anti-Glycoprotein-F H4 Research Binder Kd: 0.043 nM Tools for de novo antibody discovery and engineering
SBP Info
[1]
Fab anti-Glycoprotein-F H8 Research Binder Kd: 0.023 nM Tools for de novo antibody discovery and engineering
SBP Info
[1]
Fab anti-Glycoprotein-F RSVF2-5 Research Neutralizer N.A. Human respiratory syncytial virus infection [ICD-11: XN275]
SBP Info
[3]
References
1 Antibody Fab display and selection through fusion to the pIX coat protein of filamentous phage. J Immunol Methods. 2010 Aug 31;360(1-2):39-46.
2 Recombinant human respiratory syncytial virus (RSV) monoclonal antibody Fab is effective therapeutically when introduced directly into the lungs of RSV-infected mice. Proc Natl Acad Sci U S A. 1994 Feb 15;91(4):1386-90.
3 Isolation of a second recombinant human respiratory syncytial virus monoclonal antibody fragment (Fab RSVF2-5) that exhibits therapeutic efficacy in vivo. J Infect Dis. 1998 Apr;177(4):1073-6.