Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00168) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Fusion glycoprotein F0
|
|||||
Synonyms |
F2; p27; Intervening segment; Pep27; Peptide 27; Fusion glycoprotein F1; F1]
|
|||||
BTS Type |
Protein
|
|||||
Family |
Paramyxoviruses fusion glycoprotein family
|
|||||
Gene Name |
F
|
|||||
Organism |
Human respiratory syncytial virus A (strain A2)
|
|||||
Function |
[Fusion glycoprotein F0]: Inactive precursor that is cleaved at two sites by a furin-like protease to give rise to the mature F1 and F2 fusion glycoproteins.; [Fusion glycoprotein F1]: Class I viral fusion protein Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state During viral and plasma cell membrane fusion, the coiled coil regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain The formation of this structure appears to drive apposition and subsequent fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm This fusion is pH independent and occurs at the plasma or endosomal membrane (Probable). The trimer of F1-F2 (F protein) also facilitates the attachment to host cell by binding to host heparan sulfate F protein is involved in the entry into the host cell through the interaction with host IGFR1 This interaction activates PRKCZ/PKCzeta that recruits host NCL/nucleolin to the apical cell surface where it can bind fusion glycoprotein F1 Later in infection, F protein expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis F protein may trigger p53-dependent apoptosis ; [Fusion glycoprotein F2]: Major determinant of the species specificity of RSV infection The trimer of F1-F2 (F protein) also facilitates the attachment to host cell by binding to host heparan sulfate F protein is involved in the entry into the host cell through the interaction with host IGFR1 This interaction activates PRKCZ/PKCzeta that recruits host NCL/nucleolin to the apical cell surface where it can bind fusion glycoprotein F1 Later in infection, F protein expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis F protein seems to trigger p53-dependent apoptosis
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Sequence |
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIE
LSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLN NAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVS LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVN AGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYV VQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKV QSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT KCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLS LIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN |
|||||
Sequence Length |
574
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Fab anti-Glycoprotein-F A7 | Research | Binder | Kd: 0.036 nM | Tools for de novo antibody discovery and engineering | [1] | |
Fab anti-Glycoprotein-F B23 | Research | Binder | Kd: 0.667 nM | Tools for de novo antibody discovery and engineering | [1] | |
Fab anti-Glycoprotein-F clone 19 | Research | Binder | N.A. | Human respiratory syncytial virus infection [ICD-11: XN275] | [2] | |
Fab anti-Glycoprotein-F F8 | Research | Binder | Kd: 0.052 nM | Tools for de novo antibody discovery and engineering | [1] | |
Fab anti-Glycoprotein-F H4 | Research | Binder | Kd: 0.043 nM | Tools for de novo antibody discovery and engineering | [1] | |
Fab anti-Glycoprotein-F H8 | Research | Binder | Kd: 0.023 nM | Tools for de novo antibody discovery and engineering | [1] | |
Fab anti-Glycoprotein-F RSVF2-5 | Research | Neutralizer | N.A. | Human respiratory syncytial virus infection [ICD-11: XN275] | [3] | |
References |
---|