Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00118)
BTS Name
MCHERRY
BTS Type
Protein
Gene Name
mCherry
Organism
Escherichia coli str. K-12 substr. MG1655
UniProt ID
A0A4D6FVK6
UniProt Entry
A0A4D6FVK6_ECOLI
PFam
PF01353
Sequence
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP
FAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQD
GEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA
EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Sequence Length
236
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
DARPin anti-mCherry 2m151 Research Binder Kd: 5600 nM Research tool
SBP Info
 		[1]
DARPin anti-mCherry 2m172 Research Binder N.A. Research tool
SBP Info
 		[1]
DARPin anti-mCherry 2m22 Research Binder Kd: 6.6 nM Research tool
SBP Info
 		[1]
DARPin anti-mCherry 2m74 Research Binder Kd: 7900 nM Research tool
SBP Info
 		[1]
DARPin anti-mCherry 3m160 Research Binder Kd: 460 nM Research tool
SBP Info
 		[1]
Nanobody anti-mCherry LaM-1 Research Binder Kd: 22 nM Research tool
SBP Info
 		[2]
Nanobody anti-mCherry LaM-2 Research Binder Kd: 0.49 nM Research tool
SBP Info
 		[2], [3]
Nanobody anti-mCherry LaM-3 Research Binder Kd: 1.9 nM Research tool
SBP Info
 		[2]
Nanobody anti-mCherry LaM-4 Research Binder Kd: 0.18 nM Research tool
SBP Info
 		[2]
Nanobody anti-mCherry LaM-6 Research Binder Kd: 0.26 nM Research tool
SBP Info
 		[2]
Nanobody anti-mCherry LaM-8 Research Binder Kd: 63 nM Research tool
SBP Info
 		[2]
Nanobody anti-mCherry LaM8-AK74 Research Binder Kd: 7400 nM Tools for programmable photoswitchable regulation
SBP Info
 		[4]
Nanobody anti-mCherry LaM8-AK74-C450V Research Binder Kd: 29000 nM Tools for programmable photoswitchable regulation
SBP Info
 		[4]
Nanobody anti-mCherry LaM8-GG15 Research Binder Kd: 2500 nM Tools for programmable photoswitchable regulation
SBP Info
 		[4]
Nanobody anti-mCherry LaM8-GG15-C450V Research Binder Kd: 530 nM Tools for programmable photoswitchable regulation
SBP Info
 		[4]
References
1 Protein interference applications in cellular and developmental biology using DARPins that recognize GFP and mCherry. Biol Open. 2014 Nov 21;3(12):1252-61.
2 A robust pipeline for rapid production of versatile nanobody repertoires. Nat Methods. 2014 Dec;11(12):1253-60.
3 A Split-Luciferase Reporter Recognizing GFP and mCherry Tags to Facilitate Studies of Protein-Protein Interactions. Int J Mol Sci. 2017 Dec 11;18(12):2681.
4 Optogenetic control of protein binding using light-switchable nanobodies. Nat Commun. 2020 Aug 13;11(1):4044.