Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00031) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Fibrinogen beta chain
|
|||||
| BTS Type |
Protein
|
|||||
| Gene Name |
FGB
|
|||||
| Organism |
Bos taurus (Bovine)
|
|||||
| Function |
Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
QFPTDYDEGQDDRPKVGLGARGHRPYDKKKEEAPSLRPVPPPISGGGYRARPATATVGQK
KVERKPPDADGCLHADPDLGVLCPTGCKLQDTLVRQERPIRKSIEDLRNTVDSVSRTSSS TFQYITLLKNMWKGRQNQVQDNENVVNEYSSHLEKHQLYIDETVKNNIPTKLRVLRSILE NLRSKIQKLESDVSTQMEYCRTPCTVTCNIPVVSGKECEKIIRNEGETSEMYLIQPEDSS KPYRVYCDMKTEKGGWTVIQNRQDGSVDFGRKWDPYKQGFGNIATNAEGKKYCGVPGEYW LGNDRISQLTNMGPTKLLIEMEDWKGDKVTALYEGFTVQNEANKYQLSVSKYKGTAGNAL IEGASQLVGENRTMTIHNSMFFSTYDRDNDGWKTTDPRKQCSKEDGGGWWYNRCHAANPN GRYYWGGAYTWDMAKHGTDDGVVWMNWQGSWYSMKKMSMKIRPYFPEQ |
|||||
| Sequence Length |
468
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affimer anti-Fibrinogen/Fibrin F5 | Research | Binder | Kd: 52 nM | Tools for modulating fibrinolysis, stabilizing the blood clot, and reducing bleeding complications | [1] | |
| Affimer anti-Fibrinogen/Fibrin G2 | Research | Binder | Kd: 38 nM | Tools for modulating fibrinolysis, stabilizing the blood clot, and reducing bleeding complications | [1] | |
| pVIII-based binder anti-Fibrinogen (D/E)G(Y,F)LRP(E/D)Z mutant | Research | Binder | N.A. | Tools as alpha-helical ligands | [2] | |
| pVIII-based binder anti-Fibrinogen AYLADRAD mutant | Research | Binder | N.A. | Tools as alpha-helical ligands | [2] | |
| pVIII-based binder anti-Fibrinogen DSSVRFTG mutant | Research | Binder | N.A. | Tools as alpha-helical ligands | [2] | |
| pVIII-based binder anti-Fibrinogen EAGPRXXP mutant | Research | Binder | N.A. | Tools as alpha-helical ligands | [2] | |
| pVIII-based binder anti-Fibrinogen FDLQLLAE mutant | Research | Binder | N.A. | Tools as alpha-helical ligands | [2] | |