Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000794) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
pVIII-based binder anti-Fibrinogen EAGPRXXP mutant
|
|||||
| Synonyms |
pVIII-based binder EAGPRXXP mutant
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 50 | |||||
| SBP Sequence |
>pVIII-based binder anti-Fibrinogen EAGPRXXP mutant
AEGDDPAKAAFEAGPRXXPETIGTAWAMVVVIVGATIGIKLFKKFTSKAS |
|||||
| Sequence Description | X is occupied with an unusually high proportion (50%) of S and T. | |||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | M13 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS054 | [1] | ||||
| Scaffold Name | PVIII-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helix | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fibrinogen beta chain | Binder | Tools as alpha-helical ligands | N.A. | Auburn University | [1] | |