Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003618) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-ERK2 S380L
|
|||||
Synonyms |
DARPin S380L
|
|||||
Molecular Weight | 16.6 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Highest Status | Research | |||||
Sequence Length | 154 | |||||
SBP Sequence |
>DARPin anti-ERK2 S380L
DLGKKLLEAARAGQDDEVRILMANGADVNAHDDQGLTPLHLAAWIGHPEIVEVLLKHGAD VNARDTDGWTPLHLAADNGHLEIVEVLLKYGADVNAQDAYGLTPLHLAADRGHLEIVEVL LKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | DARPin E40 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Mitogen-activated protein kinase 1 | Inhibitor | Tools as phosphorylation-specific protein binders of ERK2 | N.A. | University of Malaya | [1] | |