General Information of Synthetic Binding Protein (SBP) (ID: SBP003618)
SBP Name
DARPin anti-ERK2 S380L
Synonyms
DARPin S380L
Molecular Weight 16.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Research
Sequence Length 154
SBP Sequence
>DARPin anti-ERK2 S380L
DLGKKLLEAARAGQDDEVRILMANGADVNAHDDQGLTPLHLAAWIGHPEIVEVLLKHGAD
VNARDTDGWTPLHLAADNGHLEIVEVLLKYGADVNAQDAYGLTPLHLAADRGHLEIVEVL
LKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name DARPin E40
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Mitogen-activated protein kinase 1
BTS Info
Inhibitor Tools as phosphorylation-specific protein binders of ERK2 N.A. University of Malaya [1]
References
1 Molecular Dynamics Simulations in Designing DARPins as Phosphorylation-Specific Protein Binders of ERK2. Molecules. 2021 Jul 27;26(15):4540.