General Information of Synthetic Binding Protein (SBP) (ID: SBP003609)
SBP Name
Nanobody anti-CD70 Nb-3B6
Synonyms
Nanobody 3B6
Molecular Weight 14.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method phage display
Highest Status Research
Sequence Length 134
SBP Sequence
>Nanobody anti-CD70 Nb-3B6
QVQLQESGGGSVQAGGSLRLSCVVSAYRGSRYSMAWFRQTPGKEREGVAAIVIGVNGGGT
IYASSVKGRFTISRDTADNTLYLQMNSLKPEDTALYYCAFRPGYMEPNIGLGIFGLFSPP
NGYWGQGTQVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
CD70 antigen
BTS Info
blocker Cancers [ICD-11: 2D4Z] Kd: 51.5 nM Xinjiang University [1]
References
1 Identification and characterization of blocking nanobodies against human CD70. Acta Biochim Biophys Sin (Shanghai). 2022 Oct 25;54(10):1518-1527.