Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003608)
SBP Name
Nanobody anti-SARS-CoV-2 Nb-H6
Synonyms
Nanobody H6
Molecular Weight 12.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 114
SBP Sequence
>Nanobody anti-SARS-CoV-2 Nb-H6
QLVESGGGLVQAGDSLRLSCAASERALSSFHMGWFRQAPGKQRAFVAAIKWRDGTTYYAD
SVKGRFTISRDNAKNTVYLQMNSLEPEDTAVYYCYYRGRWGTYWGQGTQVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Spike glycoprotein
BTS Info
Neutralizer SARS-CoV-2 [ICD-11: XN109] Kd: 632 nM Shenzhen University [1]
Spike glycoprotein
BTS Info
Neutralizer SARS-CoV-2 [ICD-11: XN109] Kd: 805 nM Shenzhen University [1]
References
1 A Na?ve Phage Display Library-Derived Nanobody Neutralizes SARS-CoV-2 and Three Variants of Concern. Int J Nanomedicine. 2023 Oct 16;18:5781-5795.