Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003605) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-SARS-CoV-2 Nb-007
|
|||||
| Synonyms |
Nanobody 007
|
|||||
| Molecular Weight | 12.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 7W1S | |||||
| Sequence Length | 112 | |||||
| SBP Sequence |
>Nanobody anti-SARS-CoV-2 Nb-007
QLQLVESGGGLVQAGGSMRLSCAASISFSSFPMGWHRQAPGKQRELVAKTGIGGTAYDDS VKGRGTISRDNTKNTVYLQMNSLKVEDTAVYYCWGWRMNDYWGQGTQVYVSS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | Neutralizer | SARS-CoV-2 [ICD-11: XN109] | Kd: 0.0674 nM | Sichuan University | [1] | |