Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003600) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-HDAC6-ZnF F10
|
|||||
Synonyms |
DARPin F10
|
|||||
Molecular Weight | 17.1 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | ribosome display | |||||
Highest Status | Research | |||||
PDB ID | 7ATT | |||||
Sequence Length | 162 | |||||
SBP Sequence |
>DARPin anti-HDAC6-ZnF F10
GSDLGKKLLEAARAGQDDEVRILMANGADVNANDRNGVTPLHLAADKGHLEIVEVLLKTG ADVNAIDIMGATPLHLAAAHGHLEIVEVLLKAGADVNAMDHKGFTPLHLAAWRGHLEIVE VLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAKLN |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Histone deacetylase 6 | Blocker | Tools for impairing infection by influenza and Zika virus at the uncoating step | Kd: 95.05 nM | University of Basel | [1] | |