Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003569) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Anticalin anti-muTfR-ED T4B11LN6
|
|||||
| Synonyms |
Anticalin T4B11LN6
|
|||||
| Molecular Weight | 20.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | E. coli | |||||
| Selection Method | bacterial cell surface display | |||||
| Highest Status | Research | |||||
| Sequence Length | 179 | |||||
| SBP Sequence |
>Anticalin anti-muTfR-ED T4B11LN6
MQDSTSDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGMAGSGWLREDKDPVKMYATIYELK EDKSYQVTTVLFHEEKCHYFIGTFVPGSQPGEFTLGTIKSTPGVTSYLVRVVSTDYNQYA MVFFKLVKQNREQFQITLYGRTKELTSELKEDFIRFSKSLGLPENHIVFPVPIDQCIDG |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | human lipocalin 2Lcn2 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS011 | [1] | ||||
| Scaffold Name | Anticalin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Transferrin receptor protein 1 | binder | Tools as lipocalin | Kd: 3.8 nM | Technische Universit?t Mnchen | [1] | |