Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003567) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affibody anti-Abeta Z(SYM73)
|
|||||
Synonyms |
Affibody Z(SYM73)
|
|||||
Molecular Weight | 11.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 | |||||
Selection Method | staphylococcal platform;Flow cytometry | |||||
Highest Status | Research | |||||
Sequence Length | 107 | |||||
SBP Sequence |
>Affibody anti-Abeta Z(SYM73)
AGGERVYLPNLNADQLCAFIRSLEDDPSQSANLLAEAKKLNDAQAPASSSSGSSSSGRAS AGGERVYLPNLNADQLCAFIRSLEDDPSQSANLLAEAKKLNDAQAPK |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | (Z(Abeta3A12))2 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS004 | [1] | ||||
Scaffold Name | Affibody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Three Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Amyloid-beta precursor protein | binder | Alzheimer disease [ICD-11: 8A20] | Kd: 0.34 nM | KTH Royal Institute of Technology | [1] | |