Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003542) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
WW domain anti-Zn(II) WW-CA
|
|||||
| Synonyms |
WW domain WW-CA
|
|||||
| Molecular Weight | 3.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 34 | |||||
| SBP Sequence |
>WW domain anti-Zn(II) WW-CA
KLPPGWEKHMSRSSGQVHYHNSITQASQWERPSG |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS067 | [1] | ||||
| Scaffold Name | WW domain | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Zinc(II) | Binder | Research tool | Kd: 1200 nM | Heidelberg University | [1] | |