General Information of Synthetic Binding Protein (SBP) (ID: SBP003514)
SBP Name
Affibody anti-EGFR Z(EGFR:1907)
Synonyms
Affibody Z(EGFR:1907)
Molecular Weight 6.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli strain RRIM15
Selection Method phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-EGFR Z(EGFR:1907)
VDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epidermal growth factor receptor
BTS Info
binder Cancers [ICD-11: 2D4Z] Kd: 5.4 nM AlbaNova University [1]
References
1 Directed evolution to low nanomolar affinity of a tumor-targeting epidermal growth factor receptor-binding affibody molecule. J Mol Biol. 2008 Mar 7;376(5):1388-402.