Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003506) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affibody anti-HER2 Z(HER2:41071)
|
|||||
| Synonyms |
Affibody Z(HER2:41071)
|
|||||
| Molecular Weight | 6.8 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase I | |||||
| Sequence Length | 61 | |||||
| SBP Sequence |
>Affibody anti-HER2 Z(HER2:41071)
AENKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLSESQAPGGG C |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS004 | [1] , [2] | ||||
| Scaffold Name | Affibody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epidermal growth factor receptor | binder | Ovarian cancer [ICD-11: 2C73.Z]; Breast cancer [ICD-11: 2C6Z] | Kd: 0.058 nM | Uppsala University; Zunyi Medical University | [1] , [2] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT05203497 | Click to show the Detail | |||||
| Indication | Breast Cancer Female | |||||
| Phase | Phase I | |||||
| Title | Molecular Imaging of HER2 Expression in Breast Cancer Using 99mTc-ZHER2 | |||||
| Status | Completed | |||||
| Sponsor | Tomsk National Research Medical Center of the Russian Academy of Sciences | |||||
| References |
|---|