General Information of Synthetic Binding Protein (SBP) (ID: SBP003503)
SBP Name
Affibody anti-HER2 Z(HER2:342)
Synonyms
Affibody Z(HER2:342)
Molecular Weight 6.7 kDa
Thermal Denaturation TEMP 68 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-HER2 Z(HER2:342)
VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1] , [2]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epidermal growth factor receptor
BTS Info
binder Ovarian cancer [ICD-11: 2C73.Z]; Breast cancer [ICD-11: 2C6Z] Kd: 0.022 nM AlbaNova University; Zunyi Medical University [1] , [2]
References
1 Advances in the Application of Radionuclide-Labeled HER2 Affibody for the Diagnosis and Treatment of Ovarian Cancer. Front Oncol. 2022 Jun 15;12:917439
2 Selection and characterization of HER2/neu-binding affibody ligands. Protein Eng Des Sel. 2004 May;17(5):455-62.