Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003491) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Miniprotein anti-SARS-CoV-2 DBC2_01
|
|||||
| Synonyms |
DBR3_03
|
|||||
| Molecular Weight | 7.4 kDa | |||||
| Design Method | de novo protein design | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 7ZSS | |||||
| Sequence Length | 66 | |||||
| SBP Sequence |
>DBR3_03
STNMLEALQQRLQFYHGQVARAALENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELP VPPGFG |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | binder | Tools for inhibiting the ACE2CRBD interaction | Kd: 80 nM | cole Polytechnique Fdrale de Lausanne | [1] | |