Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003476) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-SARS-CoV-2 clone 15
|
|||||
| Synonyms |
Sb15
|
|||||
| Molecular Weight | 12.5 kDa | |||||
| Thermal Denaturation TEMP | 67.4 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| PDB ID | 7P77; 7P78; 7P79 | |||||
| Sequence Length | 114 | |||||
| SBP Sequence |
>Nanobody anti-SARS-CoV-2 clone 15
QVQLVESGGGLVQAGGSLRLSCAASGFPVKNFEMEWYRKAPGKEREWVAAIQSGGVETYY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCFVYVGRSYIGQGTQVTVS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | Inhibitor | Research tool | Kd: 6.8 nM | National Institutes of Health, USA | [1] | |