Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003459) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Human VH dAb anti-HOIP clone 3
|
|||||
| Synonyms |
dAb3
|
|||||
| Molecular Weight | 13.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 6SC5; 6SC6; 6SC7; 6SC8; 6SC9; 6T2J | |||||
| Sequence Length | 120 | |||||
| SBP Sequence |
>Human VH dAb anti-HOIP clone 3
EVQLLESGGGLVQPGGSLRLSCAASGFTFRGYSMAWVRQAPGKGLEWVSTISPIGTYTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGSYSRGTPFDYWGQGTLVTVSS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS039 | [1] | ||||
| Scaffold Name | Human VH dAb | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RNF31 | Inhibitor | Research tool | Kd: 2.9 nM | The Francis Crick Institute | [1] | |