Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003455) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-US28Nb7 B1
|
|||||
| Synonyms |
Nanobody B1; NbB1
|
|||||
| Molecular Weight | 14.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 5WB2 | |||||
| Sequence Length | 131 | |||||
| SBP Sequence |
>Nanobody anti-CX3CL1.35 B1
QLQLVESGGGLVQPGGSLRLSCAASGYSLEYYAIGWFRQAPGKEREGVSCISTSVGSTKY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCGADLSTFYGGNYYCGDRGIYDYYG QGTQVTVSSRG |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| G-protein coupled receptor homolog US28 | Binder | Research tool | N.A. | Stanford University School of Medicine | [1] | |