Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003451) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-SARS-CoV-2 MR17
|
|||||
Synonyms |
Nanobody MR17
|
|||||
Molecular Weight | 13.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Highest Status | Research | |||||
PDB ID | 7C8W | |||||
Sequence Length | 122 | |||||
SBP Sequence |
>Nanobody anti-SARS-SoV-2 MR17
QVQLVESGGGLVQAGGSLRLSSAASGFPVEVWRMEWYRQAPGKEREGVAAIESYGHGTRY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYSNVKDDGQLAYHYDYWGQGTQVTVS AG |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Spike glycoprotein | Inhibitor | SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | Kd: 83.7 nM | Chinese Academy of Sciences (CAS) | [1] | |