Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003442) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Miniprotein anti-SARS-CoV-2 LCB7
|
|||||
| Synonyms |
Miniprotein LCB7
|
|||||
| Molecular Weight | 6.9 kDa | |||||
| Thermal Denaturation TEMP | >95 ℃ | |||||
| Design Method | de novo protein design | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 57 | |||||
| SBP Sequence |
>Miniprotein anti-SARS-CoV-2 LCB7
DDDIRYLIYMAKLRLEQGNPEEAEKVLEMARFLAERLGMEELLKEVRELLRKIEELR |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | Inhibitor | SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | Kd: 1-20 nM | University of Washington | [1] | |