General Information of Synthetic Binding Protein (SBP) (ID: SBP003441)
SBP Name
Miniprotein anti-SARS-CoV-2 LCB6
Synonyms
Miniprotein LCB6
Molecular Weight 6.7 kDa
Thermal Denaturation TEMP >95 ℃
Design Method de novo protein design
Expression System Escherichia coli
Selection Method Yeast display
Highest Status Research
Sequence Length 56
SBP Sequence
>Miniprotein anti-SARS-CoV-2 LCB6
DREQRLVRFLVRLASKFNLSPEQILQLFEVLEELLERGVSEEEIRKQLEEVAKELG
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Spike glycoprotein
BTS Info
Inhibitor SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] Kd: 1-20 nM University of Washington [1]
References
1 De novo design of picomolar SARS-CoV-2 miniprotein inhibitors.Science. 2020 Oct 23;370(6515):426-431.