Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003440) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Miniprotein anti-SARS-CoV-2 LCB5
|
|||||
Synonyms |
Miniprotein LCB5
|
|||||
Molecular Weight | 7.6 kDa | |||||
Thermal Denaturation TEMP | >95 ℃ | |||||
Design Method | de novo protein design | |||||
Expression System | Escherichia coli | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 65 | |||||
SBP Sequence |
>Miniprotein anti-SARS-CoV-2 LCB5
SLEELKEQVKELKKELSPEMRRLIEEALRFLEEGNPAMAMMVLSDLVYQLGDPRVIDLYM LVTKT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Spike glycoprotein | Inhibitor | SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | Kd: 1-20 nM | University of Washington | [1] | |