Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003429) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-beta2AR clone 6B9
|
|||||
| Synonyms |
Nanobody 6B9; Nb6B9
|
|||||
| Molecular Weight | 12.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 6H7N; 6H7M | |||||
| Sequence Length | 120 | |||||
| SBP Sequence |
>Nanobody anti-beta2AR clone 6B9
SQVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNY ANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVS S |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Nb80 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Beta-2 adrenergic receptor | Binder | Research tool | EC50: 21 nM | Stanford University | [1] | |