Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003417) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affimer anti-Fc-gamma-RIIIA F4
|
|||||
| Synonyms |
Affimer F4
|
|||||
| Molecular Weight | 12.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 5ML9 | |||||
| Sequence Length | 105 | |||||
| SBP Sequence |
>Affimer anti-Fc-gamma-RIIIA F4
AQLHSTVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQYEDEHWFPGTM YYLTLEAKDGGKKKLYEAKVWVKNTAAPPSHMNFKELQEFKPVGD |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS006 | [1] | ||||
| Scaffold Name | Affimer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets+ Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fc-gammaRIIIA | Blocker | Research tool | Kd: 217 nM | University of Leeds | [1] | |