Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003381)
SBP Name
Fab Lampalizumab
Synonyms
RG7417; RO 5490249; TNX-234
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Phase III
SBP Sequence
>VH Chain
EVQLVQSGPELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGWINTYTGETTY
ADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCEREGGVNNWGQGTLVTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
>VL Chain
DIQVTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQQKPGKVPKLLISGGNTLRPGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCLQSDSLPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Protein Scaffold Information of This SBP
Scaffold ID PS034
Scaffold Info
[1]
Scaffold Name Fab
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Complement factor D
BTS Info
Inhibitor Geographic Atrophy; Dry age related macular degeneration [ICD-11: 9B75.02] N.A. University of Bonn [1]
Clinical Trial Information of This SBP
NCT01602120 Click to show the Detail
Indication Geographic Atrophy
Phase Phase II
Title An Extension Study to Evaluate the Long-Term Safety of Lampalizumab in Participants With Geographic Atrophy
Status Terminated
Sponsor Genentech Inc
NCT02247479 Click to show the Detail
Indication Geographic Atrophy
Phase Phase III
Title A Study Investigating the Efficacy and Safety of Lampalizumab Intravitreal Injections in Participants With Geographic Atrophy Secondary to Age-Related Macular Degeneration
Status Terminated
Sponsor Hoffmann-La Roche
NCT02247531 Click to show the Detail
Indication Geographic Atrophy
Phase Phase III
Title A Study Investigating the Safety and Efficacy of Lampalizumab Intravitreal Injections in Participants With Geographic Atrophy Secondary to Age-Related Macular Degeneration
Status Terminated
Sponsor Hoffmann-La Roche
NCT02288559 Click to show the Detail
Indication Geographic Atrophy
Phase Phase II
Title A Study of Lampalizumab Intravitreal Injections Administered Every Two Weeks or Every Four Weeks to Participants With Geographic Atrophy
Status Completed
Sponsor Genentech Inc
NCT02745119 Click to show the Detail
Indication Geographic Atrophy
Phase Phase III
Title Long-Term Safety of Lampalizumab Intravitreal (ITV) Injections in Participants With Geographic Atrophy (GA) Secondary to Age-Related Macular Degeneration (OMASPECT)
Status Terminated
Sponsor Hoffmann-La Roche
References
1 Efficacy and Safety of Lampalizumab for Geographic Atrophy Due to Age-Related Macular Degeneration: Chroma and Spectri Phase 3 Randomized Clinical Trials. JAMA Ophthalmol. 2018 Jun 1;136(6):666-677.